PDB entry 5cro

View 5cro on RCSB PDB site
Description: refined structure of cro repressor protein from bacteriophage lambda
Deposited on 1998-04-17, released 1998-06-17
The last revision prior to the SCOP 1.71 freeze date was dated 1998-06-17, with a file datestamp of 1998-06-17.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.193
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d5croa_
  • Chain 'B':
    Domains in SCOP 1.71: d5crob_
  • Chain 'C':
    Domains in SCOP 1.71: d5croc_
  • Chain 'O':
    Domains in SCOP 1.71: d5croo_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5croA (A:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5croA (A:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    n
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5croB (B:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5croB (B:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    n
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5croC (C:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5croC (C:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    n
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >5croO (O:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps
    nkktta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5croO (O:)
    meqritlkdyamrfgqtktakdlgvyqsainkaihagrkifltinadgsvyaeevkpfps