PDB entry 5cr1

View 5cr1 on RCSB PDB site
Description: Crystal structure of TTR/resveratrol/T4 complex
Class: transport protein
Keywords: amyloid, fibrillogenesis, fibrillogenesis inhibitors, polyphenols, polyphenol metabolites, transthyretin, negative cooperativity, transport protein
Deposited on 2015-07-22, released 2015-10-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-12-23, with a file datestamp of 2015-12-18.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-115)
      • variant (74)
    Domains in SCOPe 2.08: d5cr1a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766 (0-End)
      • variant (74)
    Domains in SCOPe 2.08: d5cr1b_
  • Heterogens: T44, STL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cr1A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgsspfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cr1B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgsspfhehaevvftandsgprrytiaallspysysttavvtnp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cr1B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgsspfhehaevvftandsgprrytiaallspysysttavvtn