PDB entry 5cqz

View 5cqz on RCSB PDB site
Description: Human cytosolic 5'-nucleotidase II in complex with 3-(3-Imidazol-1-ylphenyl)-N-(9H-purin-6-yl)benzamide
Class: hydrolase
Keywords: HIGH KM 5-PRIME NUCLEOTIDASE, CN-II, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN, HYDROLASE-HYDROLASE EFFECTOR COMPLEX, hydrolase
Deposited on 2015-07-22, released 2015-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytosolic purine 5'-nucleotidase
    Species: Homo sapiens [TaxId:9606]
    Gene: NT5C2, NT5B, NT5CP, PNT5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cqza_
  • Chain 'B':
    Compound: cytosolic purine 5'-nucleotidase
    Species: Homo sapiens [TaxId:9606]
    Gene: NT5C2, NT5B, NT5CP, PNT5
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cqzb_
  • Heterogens: GOL, SO4, MG, 53O, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cqzA (A:)
    mgsshhhhhhssglvprgsmstswsdrlqnaadmpanmdkhalkkyrreayhrvfvnrsl
    amekikcfgfdmdytlavykspeyeslgfeltverlvsigypqellsfaydstfptrglv
    fdtlygnllkvdaygnllvcahgfnfirgpetreqypnkfiqrddterfyilntlfnlpe
    tyllaclvdfftncprytscetgfkdgdlfmsyrsmfqdvrdavdwvhykgslkektven
    lekyvvkdgklplllsrmkevgkvflatnsdykytdkimtylfdfphgpkpgsshrpwqs
    yfdlilvdarkplffgegtvlrqvdtktgklkigtytgplqhgivysggssdticdllga
    kgkdilyigdhifgdilkskkrqgwrtflvipelaqelhvwtdksslfeelqsldiflae
    lykhldsssnerpdissiqrrikkvthdmdmcygmmgslfrsgsrqtlfasqvmryadly
    aasfinllyypfsylfraahvlmphestvehthvdinemesplatrnrtsvdfkdtdykr
    hqltrsiseikppnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cqzA (A:)
    kyrreayhrvfvnrslamekikcfgfdmdytlavykspeyeslgfeltverlvsigypqe
    llsfaydstfptrglvfdtlygnllkvdaygnllvcahgfnfirgpetreqypnkfiqrd
    dterfyilntlfnlpetyllaclvdfftncprytscetgfkdgdlfmsyrsmfqdvrdav
    dwvhykgslkektvenlekyvvkdgklplllsrmkevgkvflatnsdykytdkimtylfd
    fphgpkpgsshrpwqsyfdlilvdarkplffgegtvlrqvdtktgklkigtytgplqhgi
    vysggssdticdllgakgkdilyigdhifgdkskkrqgwrtflvipelaqelhvwtdkss
    lfeelqsldiflaelykhldsssnerpdissiqrrikkvthdmdmcygmmgslfrsgsrq
    tlfasqvmryadlyaasfinllyypfsylfraahvlmphestveht
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cqzB (B:)
    mgsshhhhhhssglvprgsmstswsdrlqnaadmpanmdkhalkkyrreayhrvfvnrsl
    amekikcfgfdmdytlavykspeyeslgfeltverlvsigypqellsfaydstfptrglv
    fdtlygnllkvdaygnllvcahgfnfirgpetreqypnkfiqrddterfyilntlfnlpe
    tyllaclvdfftncprytscetgfkdgdlfmsyrsmfqdvrdavdwvhykgslkektven
    lekyvvkdgklplllsrmkevgkvflatnsdykytdkimtylfdfphgpkpgsshrpwqs
    yfdlilvdarkplffgegtvlrqvdtktgklkigtytgplqhgivysggssdticdllga
    kgkdilyigdhifgdilkskkrqgwrtflvipelaqelhvwtdksslfeelqsldiflae
    lykhldsssnerpdissiqrrikkvthdmdmcygmmgslfrsgsrqtlfasqvmryadly
    aasfinllyypfsylfraahvlmphestvehthvdinemesplatrnrtsvdfkdtdykr
    hqltrsiseikppnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cqzB (B:)
    kyrreayhrvfvnrslamekikcfgfdmdytlavykspeyeslgfeltverlvsigypqe
    llsfaydstfptrglvfdtlygnllkvdaygnllvcahgfnfirgpetreqypnkfiqrd
    dterfyilntlfnlpetyllaclvdfftncprytscetgfkdgdlfmsyrsmfqdvrdav
    dwvhykgslkektvenlekyvvkdgklplllsrmkevgkvflatnsdykytdkimtylfd
    fphgpkpgsshrpwqsyfdlilvdarkplffgegtvlrqvdtktgklkihgivysggssd
    ticdllgakgkdilyigdhifgdrqgwrtflvipelaqelhvwtdksslfeelqsldifl
    aelykhldsssnerpdissiqrrikkvthdmdmcygmmgslfrsgsrqtlfasqvmryad
    lyaasfinllyypfsylfraahvlmphestveh