PDB entry 5cqj

View 5cqj on RCSB PDB site
Description: Crystal structure of E. coli undecaprenyl pyrophosphate synthase in complex with clomiphene
Class: transferase/transferase INHIBITOR
Keywords: transferase, cell wall, wall teichoic acid, antibacterial, transferase-transferase INHIBITOR complex
Deposited on 2015-07-21, released 2015-08-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-12, with a file datestamp of 2020-02-07.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ispU, rth, uppS, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cqja_
  • Chain 'B':
    Compound: Ditrans,polycis-undecaprenyl-diphosphate synthase ((2E,6E)-farnesyl-diphosphate specific)
    Species: Escherichia coli (strain K12) [TaxId:83333]
    Gene: ispU, rth, uppS, yaeS, b0174, JW0169
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cqjb_
  • Heterogens: 53Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cqjA (A:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cqjA (A:)
    lpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyafel
    fvwaldsevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggr
    wdivqgvrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwq
    iayaelyftdvlwpdfdeqdfegalnafanre
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cqjB (B:)
    mmlsatqplseklpahgcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaann
    giealtlyafssenwnrpaqevsalmelfvwaldsevkslhrhnvrlriigdtsrfnsrl
    qerirksealtagntgltlniaanyggrwdivqgvrqlaekvqqgnlqpdqideemlnqh
    vcmhelapvdlvirtggehrisnfllwqiayaelyftdvlwpdfdeqdfegalnafanre
    rrfggtepgdeta
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cqjB (B:)
    gcrhvaiimdgngrwakkqgkirafghkagaksvrravsfaanngiealtlyaffvwald
    sevkslhrhnvrlriigdtsrfnsrlqerirksealtagntgltlniaanyggrwdivqg
    vrqlaekvqqgnlqpdqideemlnqhvcmhelapvdlvirtggehrisnfllwqiayael
    yftdvlwpdfdeqdfegalnafanre