PDB entry 5cp4

View 5cp4 on RCSB PDB site
Description: cryogenic structure of p450cam
Deposited on 1998-05-28, released 1998-09-16
The last revision prior to the SCOP 1.55 freeze date was dated 1998-09-16, with a file datestamp of 1998-09-16.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.21
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d5cp4__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cp4_ (-)
    anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
    qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
    nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
    gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
    gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
    gvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreii
    vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav