PDB entry 5cp4

View 5cp4 on RCSB PDB site
Description: cryogenic structure of p450cam
Class: oxidoreductase
Keywords: oxidoreductase, p450, monooxygenase, heme enzyme, electron transport
Deposited on 1998-05-28, released 1998-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.21
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450cam
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cp4a_
  • Heterogens: K, HEM, CAM, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cp4A (A:)
    ttetiqsnanlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcng
    ghwiatrgqlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvg
    mpvvdklenriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyl
    tdqmtrpdgsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakr
    mcglllvggldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgri
    ltsdyefhgvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgq
    hlarreiivtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cp4A (A:)
    anlaplpphvpehlvfdfdmynpsnlsagvqeawavlqesnvpdlvwtrcngghwiatrg
    qlireayedyrhfssecpfipreageaydfiptsmdppeqrqfralanqvvgmpvvdkle
    nriqelacslieslrpqgqcnftedyaepfpirifmllaglpeediphlkyltdqmtrpd
    gsmtfaeakealydylipiieqrrqkpgtdaisivangqvngrpitsdeakrmcglllvg
    gldtvvnflsfsmeflakspehrqelierperipaaceellrrfslvadgriltsdyefh
    gvqlkkgdqillpqmlsglderenacpmhvdfsrqkvshttfghgshlclgqhlarreii
    vtlkewltripdfsiapgaqiqhksgivsgvqalplvwdpattkav