PDB entry 5cor

View 5cor on RCSB PDB site
Description: x-ray structure of macrophage inflammatory protein-1 alpha (ccl3) n-terminal-switch polymer
Class: cytokine
Keywords: CC chemokine, CCL3, OLIGOMER, SIGNALING PROTEIN, CYTOKINE
Deposited on 2015-07-20, released 2016-04-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cora_
  • Chain 'B':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5corb_
  • Chain 'C':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5corc_
  • Chain 'D':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cord_
  • Chain 'E':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5core_
  • Chain 'F':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5corf_
  • Chain 'G':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5corg_
  • Chain 'H':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5corh_
  • Chain 'I':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cori_
  • Chain 'J':
    Compound: C-C motif chemokine 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CCL3, G0S19-1, MIP1A, SCYA3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5corj_
  • Heterogens: HEZ, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5corA (A:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5corB (B:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5corB (B:)
    laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
    vsdlelsa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5corC (C:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5corC (C:)
    aadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqkyv
    sdlelsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5corD (D:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5corD (D:)
    laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
    vsdlelsa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5corE (E:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5corE (E:)
    laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
    vsdlelsa
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5corF (F:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5corG (G:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5corH (H:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5corH (H:)
    laadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqky
    vsdlelsa
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5corI (I:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >5corI (I:)
    slaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvqk
    yvsdlelsa
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5corJ (J:)
    aslaadtptaccfsytsrqipqnfiadyfetssqcskpgvifltkrsrqvcadpseewvq
    kyvsdlelsa