PDB entry 5cop

View 5cop on RCSB PDB site
Description: X-ray crystal structure of wild type HIV-1 protease in complex with GRL-097
Class: hydrolase/hydrolase inhibitor
Keywords: GRL-097, HIV-1 protease, protease-inhibitor, darunavir, Tp-THF, nonpeptidic, hydroxyl, O-methoxy., HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2015-07-20, released 2016-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0X8E3 (0-98)
    • engineered mutation (24)
  Domains in SCOPe 2.05: d5copa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0X8E3 (0-98)
    • engineered mutation (24)
  Domains in SCOPe 2.05: d5copb_
• Heterogens: 53F, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5copA (A:)
  pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5copB (B:)
  pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf