PDB entry 5coo

View 5coo on RCSB PDB site
Description: X-ray crystal structure of wild type HIV-1 protease in complex with GRL-085
Class: hydrolase/hydrolase inhibitor
Keywords: GRL-085, HIV-1 protease, protease-inhibitor, darunavir, Tp-THF, nonpeptidic, hydroxyl, O-methoxy., HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2015-07-20, released 2016-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0X8E3 (0-98)
    • engineered mutation (24)
  Domains in SCOPe 2.05: d5cooa_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0X8E3 (0-98)
    • engineered mutation (24)
  Domains in SCOPe 2.05: d5coob_
• Heterogens: 52Z, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5cooA (A:)
  pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5cooB (B:)
  pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf