PDB entry 5cok

View 5cok on RCSB PDB site
Description: X-ray crystal structure of wild type HIV-1 protease in complex with GRL-0476
Class: Hydrolase/Hydrolase Inhibitor
Keywords: GRL-0476, HIV-1 protease, protease-inhibitor, darunavir, Tp-THF, nonpeptidic, Hydrolase-Hydrolase Inhibitor complex
Deposited on 2015-07-20, released 2016-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-25, with a file datestamp of 2019-12-20.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0X8E3 (0-98)
    • engineered mutation (24)
  Domains in SCOPe 2.08: d5coka_
• Chain 'B':
  Compound: hiv-1 protease
  Species: Human immunodeficiency virus 1 [TaxId:11676]
  Gene: pol
  Database cross-references and differences (RAF-indexed):
  • Uniprot G0X8E3 (0-98)
    • engineered mutation (24)
  Domains in SCOPe 2.08: d5cokb_
• Heterogens: 52U, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5cokA (A:)
  pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5cokB (B:)
  pqitlwqrplvtikiggqlkeallntgaddtvleemslpgrwkpkmiggiggfikvrqyd
  qilieicghkaigtvlvgptpvniigrnlltqigctlnf