PDB entry 5cnn

View 5cnn on RCSB PDB site
Description: Crystal structure of the EGFR kinase domain mutant I682Q
Class: transferase
Keywords: kinase EGFR, TRANSFERASE
Deposited on 2015-07-17, released 2015-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-06, with a file datestamp of 2017-09-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (13)
    Domains in SCOPe 2.07: d5cnna_
  • Chain 'B':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (13)
    Domains in SCOPe 2.07: d5cnnb_
  • Heterogens: ANP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cnnA (A:)
    gamgeapnqallrqlketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqgffsspstsrtpllsslsats
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cnnA (A:)
    pnqallrqlketefkkikvlgsgafgtvykglwipegekvkipvaikelreakankeild
    eayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcvqi
    akgmnyledrrlvhrdlaarnvlvktpqhvkitdfglaklkvpikwmalesilhriythq
    sdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcwmid
    adsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddvvdad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cnnB (B:)
    gamgeapnqallrqlketefkkikvlgsgafgtvykglwipegekvkipvaikelreats
    pkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsq
    yllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeekeyhae
    ggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekger
    lpqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpsp
    tdsnfyralmdeedmddvvdadeylipqqgffsspstsrtpllsslsats
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cnnB (B:)
    nqallrqlketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkankei
    ldeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkdnigsqyllnwcv
    qiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgkvpikwmalesilhri
    ythqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkc
    wmidadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyralmdeedmddv
    vdad