PDB entry 5cnj

View 5cnj on RCSB PDB site
Description: mGlur2 with glutamate analog
Class: signaling protein
Keywords: glutamate receptor analog, SIGNALING PROTEIN
Deposited on 2015-07-17, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-07, with a file datestamp of 2015-10-02.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Metabotropic glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM2, GPRC1B, MGLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14416
      • conflict (235)
    Domains in SCOPe 2.07: d5cnja_
  • Chain 'B':
    Compound: Metabotropic glutamate receptor 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRM2, GPRC1B, MGLUR2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14416
      • conflict (235)
    Domains in SCOPe 2.07: d5cnjb_
  • Heterogens: NAG, 52Q, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cnjA (A:)
    malgsllallallllwgavaegpakkvltlegdlvlgglfpvhqkggpaedcgpvnehrg
    iqrleamlfaldrinrdphllpgvrlgahildscskdthaleqaldfvraslsrgadgsr
    hicpdgsyathgdaptaitgviggsysdvsiqvanllrlfqipqisyastsaklsdksry
    dyfartvppdffqakamaeilrffnwtyvstvasegdygetgieafeleararnisvats
    ekvgramsraafegvvrallqkpsarvavlftrsedarellaasqrlnasftwvasdgwg
    alesvvagsegaaegaitielasypisdfasyfqsldpwnnsrnpwfrefweqrfrcsfr
    qrdcaahslravpfeqeskimfvvnavyamahalhnmhralcpnttrlcdamrpvngrrl
    ykdfvlnvkfdapfrpadthnevrfdrfgdgigryniftylragsgryryqkvgywaegl
    tldtslipwaspsageghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cnjA (A:)
    akkvltlegdlvlgglfpvhqkggpaedcgpvnehrgiqrleamlfaldrinrdphllpg
    vrlgahildscskdthaleqaldfvraslptaitgviggsysdvsiqvanllrlfqipqi
    syastsaklsdksrydyfartvppdffqakamaeilrffnwtyvstvasegdygetgiea
    feleararnisvatsekvgramsraafegvvrallqkpsarvavlftrsedarellaasq
    rlnasftwvasdgwgalesvvagsegaaegaitielasypisdfasyfqsldpwnnsrnp
    wfrefweqrfrcsfrqrdcaahslravpfeqeskimfvvnavyamahalhnmhralcpnt
    trlcdamrpvngrrlykdfvlnvkfdapfrpadthnevrfdrfgdgigryniftylrags
    gryryqkvgywaegltldtslipwa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cnjB (B:)
    malgsllallallllwgavaegpakkvltlegdlvlgglfpvhqkggpaedcgpvnehrg
    iqrleamlfaldrinrdphllpgvrlgahildscskdthaleqaldfvraslsrgadgsr
    hicpdgsyathgdaptaitgviggsysdvsiqvanllrlfqipqisyastsaklsdksry
    dyfartvppdffqakamaeilrffnwtyvstvasegdygetgieafeleararnisvats
    ekvgramsraafegvvrallqkpsarvavlftrsedarellaasqrlnasftwvasdgwg
    alesvvagsegaaegaitielasypisdfasyfqsldpwnnsrnpwfrefweqrfrcsfr
    qrdcaahslravpfeqeskimfvvnavyamahalhnmhralcpnttrlcdamrpvngrrl
    ykdfvlnvkfdapfrpadthnevrfdrfgdgigryniftylragsgryryqkvgywaegl
    tldtslipwaspsageghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cnjB (B:)
    kkvltlegdlvlgglfpvhqkggpaedcgpvnehrgiqrleamlfaldrinrdphllpgv
    rlgahildscskdthaleqaldfvraslsptaitgviggsysdvsiqvanllrlfqipqi
    syastsaklsdksrydyfartvppdffqakamaeilrffnwtyvstvasegdygetgiea
    feleararnisvatsekvgramsraafegvvrallqkpsarvavlftrsedarellaasq
    rlnasftwvasdgwgalesvvagsegaaegaitielasypisdfasyfqsldpwnnsrnp
    wfrefweqrfrcsfrqrdcaahslravpfeqeskimfvvnavyamahalhnmhralcpnt
    trlcdamrpvngrrlykdfvlnvkfdapfrpadthnevrfdrfgdgigryniftylrags
    gryryqkvgywaegltldtslipwa