PDB entry 5cn9

View 5cn9 on RCSB PDB site
Description: Ultrafast dynamics in myoglobin: 0.4 ps time delay
Class: oxygen storage
Keywords: serial femtosecond crystallography, time-resolved crystallography, free-electron laser, protein dynamics, carbon monoxide, oxygen storage
Deposited on 2015-07-17, released 2015-09-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cn9a_
  • Heterogens: SO4, CMO, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cn9A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq