PDB entry 5cn6

View 5cn6 on RCSB PDB site
Description: Ultrafast dynamics in myoglobin: 0.1 ps time delay
Class: oxygen storage
Keywords: serial femtosecond crystallography, time-resolved crystallography, free-electron laser, protein dynamics, carbon monoxide, oxygen storage
Deposited on 2015-07-17, released 2015-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-14, with a file datestamp of 2018-11-09.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cn6a_
  • Heterogens: HEM, SO4, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cn6A (A:)
    glsdgewqqvlnvwgkveadiaghgqevlirlftghpetlekfdkfkhlkteaemkased
    lkkhgtvvltalggilkkkghheaelkplaqshatkhkipikylefisdaiihvlhskhp
    gdfgadaqgamtkalelfrndiaakykelgfq