PDB entry 5cn3

View 5cn3 on RCSB PDB site
Description: X-ray structure of wild-type TTR at 1.30A resolution
Class: transport protein
Keywords: TTR, ATTR, prealbumin, transport protein
Deposited on 2015-07-17, released 2016-07-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-10, with a file datestamp of 2016-08-05.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cn3a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cn3b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cn3A (A:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    ttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cn3A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cn3B (B:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    ttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cn3B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp