PDB entry 5cmq

View 5cmq on RCSB PDB site
Description: Crystal Structure of Zn-bound Human H-Ferritin variant 122H-delta C-star
Class: oxidoreductase
Keywords: Protein Engineering, Metal Binding, OXIDOREDUCTASE
Deposited on 2015-07-17, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ferritin heavy chain
    Species: Homo sapiens [TaxId:9606]
    Gene: FTH1, FTH, FTHL6, OK/SW-cl.84, PIG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02794
      • engineered mutation (85)
      • engineered mutation (89)
      • engineered mutation (101)
      • engineered mutation (121)
      • engineered mutation (129)
    Domains in SCOPe 2.07: d5cmqa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cmqA (A:)
    ttastsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsh
    eerehaeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhkl
    ahdkndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlgdsdn
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cmqA (A:)
    tsqvrqnyhqdseaainrqinlelyasyvylsmsyyfdrddvalknfakyflhqsheere
    haeklmklqnqrggriflqdiqkpdeddwesglnameaalhleknvnqsllelhklahdk
    ndphladfiethylneqvkaikelgdhvtnlrkmgapesglaeylfdkhtlg