PDB entry 5cm1

View 5cm1 on RCSB PDB site
Description: X-ray structure of perdeuterated TTR mutant - T119M at 1.22A
Class: transport protein
Keywords: TTR, ATTR, prealbumin, transport protein
Deposited on 2015-07-16, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: N/A
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (121)
    Domains in SCOPe 2.07: d5cm1a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • engineered mutation (121)
    Domains in SCOPe 2.07: d5cm1b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cm1A (A:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    tmavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cm1A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cm1B (B:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    tmavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cm1B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysystmavvtnp