PDB entry 5clx

View 5clx on RCSB PDB site
Description: X-ray structure of perdeuterated TTR mutant - S52P at 1.28A resolution
Class: transport protein
Keywords: TTR, ATTR, prealbumin, transport protein
Deposited on 2015-07-16, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.28 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • conflict (54)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d5clxa_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02766
      • conflict (54)
      • engineered mutation (54)
    Domains in SCOPe 2.07: d5clxb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5clxA (A:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsepgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    ttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5clxA (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsepgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5clxB (B:)
    gamgptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsepgelhg
    ltteeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysys
    ttavvtnpke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5clxB (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsepgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp