PDB entry 5cll

View 5cll on RCSB PDB site
Description: Truncated Ran wild type in complex with GDP-BeF and RanBD1
Class: hydrolase
Keywords: GTPase, nuclear transport, hydrolase, Ran binding protein
Deposited on 2015-07-16, released 2015-09-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-10-14, with a file datestamp of 2015-10-09.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5clla_
  • Chain 'B':
    Compound: E3 SUMO-protein ligase RanBP2
    Species: Homo sapiens [TaxId:9606]
    Gene: RANBP2, NUP358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cllb_
  • Chain 'C':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cllc_
  • Chain 'D':
    Compound: E3 SUMO-protein ligase RanBP2
    Species: Homo sapiens [TaxId:9606]
    Gene: RANBP2, NUP358
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5clld_
  • Heterogens: GDP, BEF, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cllA (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cllA (A:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cllB (B:)
    etdggsahgdddddgphfepvvplpdkievktgeedeeeffcnraklfrfdveskewker
    gignvkilrhktsgkirllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyade
    lpkpeqlairfktpeeaalfkckfeeaqsilkapgtnvamasnqavr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cllB (B:)
    gphfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsg
    kirllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktp
    eeaalfkckfeeaqsilka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cllC (C:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cllC (C:)
    qvqfklvlvgdggtgkttfvkrhltgefekkyvatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cllD (D:)
    etdggsahgdddddgphfepvvplpdkievktgeedeeeffcnraklfrfdveskewker
    gignvkilrhktsgkirllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyade
    lpkpeqlairfktpeeaalfkckfeeaqsilkapgtnvamasnqavr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cllD (D:)
    gphfepvvplpdkievktgeedeeeffcnraklfrfdveskewkergignvkilrhktsg
    kirllmrreqvlkicanhyispdmkltpnagsdrsfvwhaldyadelpkpeqlairfktp
    eeaalfkckfeeaqsilka