PDB entry 5clj

View 5clj on RCSB PDB site
Description: Structure of PurE (N5-carboxyaminoimidazole ribonucleotide mutase) H59N from the acidophilic bacterium Acetobacter aceti, complexed with AIR (5-aminoimidazole ribonucleotide) and CO2
Class: isomerase
Keywords: acidophile, purine biosynthesis, PurE, isomerase
Deposited on 2015-07-16, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5clja_
  • Chain 'B':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cljb_
  • Heterogens: AIR, CO2, CIT, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cljA (A:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsan
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cljA (A:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivsanrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletwralqtasvpnspit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cljB (B:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsan
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cljB (B:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivsanrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletwralqtasvpnspit