PDB entry 5clh

View 5clh on RCSB PDB site
Description: Structure of PurE (N5-carboxyaminoimidazole ribonucleotide mutase) H59N from the acidophilic bacterium Acetobacter aceti, at pH 8
Class: isomerase
Keywords: acidophile, purE, purine biosynthesis, ISOMERASE
Deposited on 2015-07-16, released 2016-07-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5clha_
  • Chain 'B':
    Compound: N5-carboxyaminoimidazole ribonucleotide mutase
    Species: Acetobacter aceti 1023 [TaxId:1457393]
    Gene: purE, AZ09_02690
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5clhb_
  • Heterogens: ACT, EDO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5clhA (A:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsan
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5clhA (A:)
    apvvgiimgsqsdwetmrhadallteleiphetlivsanrtpdrladyartaaerglnvi
    iagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasga
    knaallaasilalynpalaarletwralqtasvpnspit
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5clhB (B:)
    mmsetaplpsassaledkaasapvvgiimgsqsdwetmrhadallteleiphetlivsan
    rtpdrladyartaaerglnviiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsll
    sivqmpggvpvgtlaigasgaknaallaasilalynpalaarletwralqtasvpnspit
    edk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5clhB (B:)
    sapvvgiimgsqsdwetmrhadallteleiphetlivsanrtpdrladyartaaerglnv
    iiagaggaahlpgmcaawtrlpvlgvpvesralkgmdsllsivqmpggvpvgtlaigasg
    aknaallaasilalynpalaarletwralqtasvpnspit