PDB entry 5ckx

View 5ckx on RCSB PDB site
Description: Non-covalent complex of DAHP synthase and chorismate mutase from Mycobacterium tuberculosis with bound transition state analog and feedback effectors tyrosine and phenylalanine
Class: transferase/isomerase
Keywords: Protein complex, shikimate pathway, DAHP-synthase, chorismate mutase, transferase-isomerase complex
Deposited on 2015-07-15, released 2016-03-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-20, with a file datestamp of 2016-07-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase arog
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: aroG, Rv2178c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ckxa_
  • Chain 'B':
    Compound: phospho-2-dehydro-3-deoxyheptonate aldolase arog
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: aroG, Rv2178c
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5ckxb_
  • Chain 'C':
    Compound: Intracellular chorismate mutase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv0948c, MTCY10D7.26
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Intracellular chorismate mutase
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: Rv0948c, MTCY10D7.26
    Database cross-references and differences (RAF-indexed):
  • Heterogens: MN, GOL, CL, SO4, PHE, TYR, TSA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ckxA (A:)
    mhhhhhhssgmnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrt
    vlesvppvtvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqma
    vvltygasmpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlv
    rayanasaamnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsa
    cgvadrnlqtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidg
    ahiafaqvianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppi
    vekvqatghqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihv
    eitgenvteclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ckxA (A:)
    wtvdipidpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvpseivrl
    qeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvvkvari
    agqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnlvralt
    ssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvaeiyashealvldy
    eramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvianpvgvklgpnmtpe
    laveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqviwqcdpmhgnthe
    sstgfktrhfdrivdevqgffevhralgthpggihveitgenvteclggaqdisetdlag
    ryetacdprlntqqslelaflvaemlrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5ckxB (B:)
    mhhhhhhssgmnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrt
    vlesvppvtvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqma
    vvltygasmpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlv
    rayanasaamnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsa
    cgvadrnlqtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidg
    ahiafaqvianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppi
    vekvqatghqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihv
    eitgenvteclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ckxB (B:)
    mnwtvdipilpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppvtvpseiv
    rlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygasmpvvkva
    riagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasaamnlvra
    ltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvataeiyasheal
    vldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqvianpvgvklgpn
    mtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatghqviwqcdpmhg
    nthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvteclggaqdiset
    dlagryetacdprlntqqslelaflvaemlrd
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.