PDB entry 5ckg

View 5ckg on RCSB PDB site
Description: Human beta-2 microglobulin mutant V85E
Class: immune system
Keywords: Aggregation propensity, Amyloid, beta-sandwitch, fold stability, immune system
Deposited on 2015-07-15, released 2016-05-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-05-18, with a file datestamp of 2016-05-13.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • initiating methionine (0)
    • engineered mutation (85)
  Domains in SCOPe 2.08: d5ckga_
• Chain 'B':
  Compound: Beta-2-microglobulin
  Species: Homo sapiens [TaxId:9606]
  Gene: B2M, CDABP0092, HDCMA22P
  Database cross-references and differences (RAF-indexed):
  • Uniprot P61769 (1-99)
    • initiating methionine (0)
    • engineered mutation (85)
  Domains in SCOPe 2.08: d5ckgb_
• Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ckgA (A:)
  miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
  wsfyllyyteftptekdeyacrvnhetlsqpkivkwdrdm
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5ckgB (B:)
  miqrtpkiqvysrhpaengksnflncyvsgfhpsdievdllkngeriekvehsdlsfskd
  wsfyllyyteftptekdeyacrvnhetlsqpkivkwdrdm