PDB entry 5cjp

View 5cjp on RCSB PDB site
Description: The Structural Basis for Cdc42-Induced Dimerization of IQGAPs
Class: protein binding
Keywords: IQGAP2 GAP related domain X-ray GTPase interactions Complex Cdc42, PROTEIN BINDING
Deposited on 2015-07-14, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-20, with a file datestamp of 2017-09-15.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division cycle 42 (GTP binding protein, 25kDa), isoform CRA_a
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42, hCG_1981007
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A024RAE4 (2-178)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5cjpa_
  • Chain 'B':
    Compound: Cell division cycle 42 (GTP binding protein, 25kDa), isoform CRA_a
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42, hCG_1981007
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A024RAE4 (2-178)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5cjpb_
  • Chain 'C':
    Compound: Cell division cycle 42 (GTP binding protein, 25kDa), isoform CRA_a
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42, hCG_1981007
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A024RAE4 (2-178)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5cjpc_
  • Chain 'D':
    Compound: Cell division cycle 42 (GTP binding protein, 25kDa), isoform CRA_a
    Species: Homo sapiens [TaxId:9606]
    Gene: CDC42, hCG_1981007
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A024RAE4 (2-178)
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5cjpd_
  • Chain 'E':
    Compound: Ras GTPase-activating-like protein IQGAP2
    Species: Homo sapiens [TaxId:9606]
    Gene: IQGAP2
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Ras GTPase-activating-like protein IQGAP2
    Species: Homo sapiens [TaxId:9606]
    Gene: IQGAP2
    Database cross-references and differences (RAF-indexed):
  • Heterogens: GTP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cjpA (A:)
    gamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cjpA (A:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cjpB (B:)
    gamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cjpB (B:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cjpC (C:)
    gamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cjpC (C:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cjpD (D:)
    gamqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdt
    agledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqid
    lrddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cjpD (D:)
    mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
    ledydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
    ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaal
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.