PDB entry 5cjj

View 5cjj on RCSB PDB site
Description: The crystal structure of phosphoribosylglycinamide formyltransferase from Campylobacter jejuni subsp. jejuni NCTC 11168
Class: transferase
Keywords: structural genomics, The Center for Structural Genomics of Infectious Diseases, CSGID, TRANSFERASE
Deposited on 2015-07-14, released 2015-07-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) [TaxId:192222]
    Gene: purN, Cj0187c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PBV2 (3-190)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5cjja1, d5cjja2
  • Chain 'B':
    Compound: phosphoribosylglycinamide formyltransferase
    Species: Campylobacter jejuni subsp. jejuni serotype O:2 (strain NCTC 11168) [TaxId:192222]
    Gene: purN, Cj0187c
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PBV2 (3-190)
      • expression tag (1-2)
    Domains in SCOPe 2.07: d5cjjb1, d5cjjb2
  • Heterogens: GOL, PEG, CL, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cjjA (A:)
    snamlvklavlfsgngsnlenileklhkktigentyeivlclcnkkdafgiqrakkfgln
    tviidhkayntreefdtilvqkikesganltvlagfmrilspvftknikainlhpsllpl
    fkgahaikesyesdmkvagvsvhwvseeldggmiiaqkafekrnlsfeefeekihslehe
    ilplsvieifs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cjjA (A:)
    namlvklavlfsgngsnlenileklhkktigentyeivlclcnkkdafgiqrakkfglnt
    vikayntreefdtilvqkikesganltvlagfmrilspvftknikainlhpsllplfkga
    haikesyesdmkvagvsvhwvseeldggmiiaqkafekrnlsfeefeekihsleheilpl
    svieifs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cjjB (B:)
    snamlvklavlfsgngsnlenileklhkktigentyeivlclcnkkdafgiqrakkfgln
    tviidhkayntreefdtilvqkikesganltvlagfmrilspvftknikainlhpsllpl
    fkgahaikesyesdmkvagvsvhwvseeldggmiiaqkafekrnlsfeefeekihslehe
    ilplsvieifs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cjjB (B:)
    namlvklavlfsgngsnlenileklhkktigentyeivlclcnkkdafgiqrakkfglnt
    viidhkayntreefdtilvqkikesganltvlagfmrilspvftknikainlhpsllplf
    kgahaikesyesdmkvagvsvhwvseeldggmiiaqkafekrnlsfeefeekihslehei
    lplsvieifs