PDB entry 5cjf

View 5cjf on RCSB PDB site
Description: The crystal structure of the human carbonic anhydrase XIV in complex with a 1,1'-biphenyl-4-sulfonamide inhibitor.
Class: lyase
Keywords: 1, 1'-Biphenyl-4-sulfonamide, Lyase, Glycoprotein, Zinc-binding, Complex, Inhibitor
Deposited on 2015-07-14, released 2015-11-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 1.83 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: CA14, UNQ690/PRO1335
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cjfa_
  • Heterogens: ZN, 520, GOL, SO4, NAG, BMA, MAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cjfA (A:)
    adggqhwtyegphgqdhwpasypecgnnaqspidiqtdsvtfdpdlpalqphgydqpgte
    pldlhnnghtvqlslpstlylgglprkyvaaqlhlhwgqkgspggsehqinseatfaelh
    ivhydsdsydslseaaerpqglavlgilievgetkniayehilshlhevrhkdqktsvpp
    fnlrellpkqlgqyfryngslttppcyqsvlwtvfyrrsqismeqleklqgtlfsteeep
    skllvqnyralqplnqrmvfasfiqagssyttgemlvpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cjfA (A:)
    hwtyegphgqdhwpasypecgnnaqspidiqtdsvtfdpdlpalqphgydqpgtepldlh
    nnghtvqlslpstlylgglprkyvaaqlhlhwgqkgspggsehqinseatfaelhivhyd
    sdsydslseaaerpqglavlgilievgetkniayehilshlhevrhkdqktsvppfnlre
    llpkqlgqyfryngslttppcyqsvlwtvfyrrsqismeqleklqgtlfsteeepskllv
    qnyralqplnqrmvfasfiqagssytt