PDB entry 5cj9

View 5cj9 on RCSB PDB site
Description: Bacillus halodurans Arginine repressor, ArgR
Class: transcription regulator
Keywords: structural analysis, ArgR, transcriptional regulator, TRANSCRIPTION REGULATOR
Deposited on 2015-07-14, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-06-29, with a file datestamp of 2016-06-24.
Experiment type: XRAY
Resolution: 2.41 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Arginine repressor
    Species: Bacillus halodurans [TaxId:272558]
    Gene: argR, ahrC, BH2777
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K973 (2-145)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5cj9a1, d5cj9a2, d5cj9a3
  • Heterogens: PGO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cj9A (A:)
    gsrhikireiianndvetqdelveqlkaagynvtqatvsrdikelhlvkvpmmdgrykys
    lpadqrfnplqklkrglvdsfvsidrtdnlivmktlpgnahaigalidnldwteimgtic
    gddtiliickdkqdgpvvterflnml