PDB entry 5cj2

View 5cj2 on RCSB PDB site
Description: Ran GDP Y39A mutant triclinic crystal form
Class: hydrolase
Keywords: GTPase, nuclear transport, transport protein, hydrolase
Deposited on 2015-07-13, released 2015-09-09
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-09-09, with a file datestamp of 2015-09-04.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (38)
    Domains in SCOPe 2.05: d5cj2a_
  • Chain 'B':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (38)
    Domains in SCOPe 2.05: d5cj2b_
  • Chain 'C':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (38)
    Domains in SCOPe 2.05: d5cj2c_
  • Chain 'D':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (38)
    Domains in SCOPe 2.05: d5cj2d_
  • Chain 'E':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (38)
    Domains in SCOPe 2.05: d5cj2e_
  • Chain 'F':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (38)
    Domains in SCOPe 2.05: d5cj2f_
  • Chain 'G':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (38)
    Domains in SCOPe 2.05: d5cj2g_
  • Chain 'H':
    Compound: GTP-binding nuclear protein ran
    Species: Homo sapiens [TaxId:9606]
    Gene: RAN, ARA24, OK/SW-cl.81
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62826
      • engineered mutation (38)
    Domains in SCOPe 2.05: d5cj2h_
  • Heterogens: GDP, MG, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cj2A (A:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cj2A (A:)
    qvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdleva
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cj2B (B:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cj2B (B:)
    pqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdt
    agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
    kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
    vvmdpalaaqyehdlevaq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cj2C (C:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cj2C (C:)
    vqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdtag
    qekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdikd
    rkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappevv
    mdpalaaqyehdlevaqt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cj2D (D:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cj2D (D:)
    pqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdt
    agqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdi
    kdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappe
    vvmdpalaaqyehdleva
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5cj2E (E:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cj2E (E:)
    qvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdlevaqtt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5cj2F (F:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cj2F (F:)
    qvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdleva
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5cj2G (G:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cj2G (G:)
    qvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdleva
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5cj2H (H:)
    maaqgepqvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpik
    fnvwdtagqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlc
    gnkvdikdrkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvamp
    alappevvmdpalaaqyehdlevaqttalpdedddl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cj2H (H:)
    qvqfklvlvgdggtgkttfvkrhltgefekkavatlgvevhplvfhtnrgpikfnvwdta
    gqekfgglrdgyyiqaqcaiimfdvtsrvtyknvpnwhrdlvrvcenipivlcgnkvdik
    drkvkaksivfhrkknlqyydisaksnynfekpflwlarkligdpnlefvampalappev
    vmdpalaaqyehdleva