PDB entry 5cht

View 5cht on RCSB PDB site
Description: Crystal structure of USP18
Class: hydrolase
Keywords: Ubiquitin-specific protease, ISG15, interferon, hydrolase
Deposited on 2015-07-10, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubl carboxyl-terminal hydrolase 18
    Species: Mus musculus [TaxId:10090]
    Gene: Usp18, Ubp43
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WTV6 (3-End)
      • expression tag (0-2)
    Domains in SCOPe 2.07: d5chta1, d5chta2
  • Chain 'B':
    Compound: Ubl carboxyl-terminal hydrolase 18
    Species: Mus musculus [TaxId:10090]
    Gene: Usp18, Ubp43
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5chtb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5chtA (A:)
    gpgdsphglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlll
    llekmqdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlq
    glftiwtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelass
    dmccescgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlp
    teedlgdtkeqseihyelfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkd
    vqctygnhryrwretayllvytktgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chtA (A:)
    gpgdsphglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlll
    llekmqdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlq
    glftiwtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelass
    dmccescgektpwkqvlklthlpqtltihlmrfsartekichsvnfpqsldfsqveihye
    lfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctygnhryrwretay
    llvytktg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5chtB (B:)
    gpgdsphglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlll
    llekmqdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlq
    glftiwtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelass
    dmccescgektpwkqvlklthlpqtltihlmrfsarnsrtekichsvnfpqsldfsqvlp
    teedlgdtkeqseihyelfaviahvgmadfghycayirnpvdgkwfcfndshvcwvtwkd
    vqctygnhryrwretayllvytktgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chtB (B:)
    phglvglhnigqtcclnsllqvfmmnmdfrmilkritvprsaeerkrsvpfqlllllekm
    qdsrqkavlptelvqclqkynvplfvqhdaaqlyltiwnltkdqitdtdlterlqglfti
    wtqeslicvgctaessrrsklltlslplfdkdakplktledalrcfvqpkelassdmcce
    scgektpwkqvlklthlpqtltihlmrfstekichsvnfpqsldfsqveihyelfaviah
    vgmadfghycayirnpvdgkwfcfndshvcwvtwkdvqctygnhryrwretayllvytkt