PDB entry 5chn

View 5chn on RCSB PDB site
Description: Fab fragments of chikungunya virus neutralizing human monoclonal antibody 5M16
Class: immune system
Keywords: antibody, IMMUNE SYSTEM
Deposited on 2015-07-10, released 2015-11-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-11, with a file datestamp of 2015-11-06.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Antibody 5M16 Fab Heavy Chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 5CHN (0-221)
• Chain 'B':
  Compound: Antibody 5M16 Fab Light Chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 5CHN (0-217)
  Domains in SCOPe 2.05: d5chnb1, d5chnb2
• Chain 'H':
  Compound: Antibody 5M16 Fab Heavy Chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 5CHN (0-221)
• Chain 'L':
  Compound: Antibody 5M16 Fab Light Chain
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • PDB 5CHN (0-217)
  Domains in SCOPe 2.05: d5chnl1, d5chnl2
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5chnB (B:)
  ivmtqtplslsvtpgqpasisckssqsllhsdgktylywylqkpgqspqlliyevsnrls
  gvpdrfsgsgsgtdftlkisrvetedvgvyycmqsiqvplytfgqgtrleikrtvaapsv
  fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
  sstltlskadyekhkvyacevthqglsspvtksfnrge
  

  
  
• Chain 'H':
  No sequence available.
  
  
• Chain 'L':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5chnL (L:)
  ivmtqtplslsvtpgqpasisckssqsllhsdgktylywylqkpgqspqlliyevsnrls
  gvpdrfsgsgsgtdftlkisrvetedvgvyycmqsiqvplytfgqgtrleikrtvaapsv
  fifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstysl
  sstltlskadyekhkvyacevthqglsspvtksfnrge