PDB entry 5cha

View 5cha on RCSB PDB site
Description: the refinement and the structure of the dimer of alpha-*chymotrypsin at 1.67-*angstroms resolution
Deposited on 1985-01-22, released 1985-04-01
The last revision prior to the SCOP 1.55 freeze date was dated 1987-10-16, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.67 Å
R-factor: 0.179
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d5chaa_
  • Chain 'B':
    Domains in SCOP 1.55: d5chab_
  • Chain 'C':
    no info in PDB for this chain
  • Chain 'E':
    no info in PDB for this chain
  • Chain 'F':
    no info in PDB for this chain
  • Chain 'G':
    no info in PDB for this chain

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5chaA (A:)
    cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chaA (A:)
    cgvpaiqpvivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvv
    vagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsa
    sddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagasgv
    sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5chaB (B:)
    cgvpaiqpvlsglxxivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltryxxantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >5chaB (B:)
    cgvpaiqpvivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdvv
    vagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsavclpsa
    sddfaagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagasgv
    sscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'C':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.