PDB entry 5cgp

View 5cgp on RCSB PDB site
Description: Selective pharmacological inhibition of the CREB binding protein bromodomain regulates inflammatory cytokines in macrophages and RGS4 in neurons
Class: transcription/inhibitor
Keywords: inhibitor, complex, TRANSCRIPTION-INHIBITOR complex
Deposited on 2015-07-09, released 2016-04-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-04-20, with a file datestamp of 2016-04-15.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5cgpa_
  • Heterogens: 53W, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5cgpA (A:)
smrkkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlsti
krkldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg

    Sequence, based on observed residues (ATOM records): (download) 
    >5cgpA (A:)
kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg