PDB entry 5cg7

View 5cg7 on RCSB PDB site
Description: Leishmania siamensis Triosephosphate isomerase
Class: hydrolase
Keywords: TIM barrel, C2 structure, cacodylate binding Cys57, HYDROLASE
Deposited on 2015-07-09, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: triosephosphate isomerase
    Species: Leishmania sp. 'siamensis' [TaxId:438838]
    Gene: TIM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cg7a_
  • Chain 'B':
    Compound: triosephosphate isomerase
    Species: Leishmania sp. 'siamensis' [TaxId:438838]
    Gene: TIM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cg7b_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cg7A (A:)
    mgsshhhhhhssglvprgshmsakpqpivaanwkcngttasieklvqvlnehqidhdvqc
    vvapsfvhipmvqaklcnpkyavsaenaiaksgaftgevsmpilkdlgvswvilghserr
    tyygetdgvvaqkvadaynqgfmviacigetlqqreanqtakvvlsqtaaiaaklpkeaw
    sqivlayepvwaigtgkvatpeqaqevhallrqwvsekigngvatklrilyggsvtagna
    ktlymkpdingflvggaslkpefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cg7A (A:)
    akpqpivaanwkcngttasieklvqvlnehqidhdvqcvvapsfvhipmvqaklcnpkya
    vsaenaiaksgaftgevsmpilkdlgvswvilghserrtyygetdgvvaqkvadaynqgf
    mviacigetlqqreanqtakvvlsqtaaiaaklpkeawsqivlayepvwaivatpeqaqe
    vhallrqwvsekigngvatklrilyggsvtagnaktlymkpdingflvggaslkpefrdi
    idatr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cg7B (B:)
    mgsshhhhhhssglvprgshmsakpqpivaanwkcngttasieklvqvlnehqidhdvqc
    vvapsfvhipmvqaklcnpkyavsaenaiaksgaftgevsmpilkdlgvswvilghserr
    tyygetdgvvaqkvadaynqgfmviacigetlqqreanqtakvvlsqtaaiaaklpkeaw
    sqivlayepvwaigtgkvatpeqaqevhallrqwvsekigngvatklrilyggsvtagna
    ktlymkpdingflvggaslkpefrdiidatr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cg7B (B:)
    akpqpivaanwkcngttasieklvqvlnehqidhdvqcvvapsfvhipmvqaklcnpkya
    vsaenaiaksgaftgevsmpilkdlgvswvilghserrtyygetdgvvaqkvadaynqgf
    mviacigetlqqreanqtakvvlsqtaaiaaklpkeawsqivlayepvwaikvatpeqaq
    evhallrqwvsekigngvatklrilyggsvtagnaktlymkpdingflvggaslkpefrd
    iidatr