PDB entry 5cg4

View 5cg4 on RCSB PDB site
Description: Crystal Structure of Macrophage Migration Inhibitory Factor bound to MTX
Class: isomerase/inhibitor
Keywords: MIF, Drug discovery, Rheumatoid Arthritis, ISOMERASE-INHIBITOR complex
Deposited on 2015-07-09, released 2016-07-13
Made obsolete by 5xej on 2018-07-25

The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-13, with a file datestamp of 2016-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cg4a_
  • Chain 'B':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cg4b_
  • Chain 'C':
    Compound: macrophage migration inhibitory factor
    Species: Homo sapiens [TaxId:9606]
    Gene: MIF, GLIF, MMIF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cg4c_
  • Heterogens: SO4, 6UV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5cg4A (A:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5cg4B (B:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >5cg4C (C:)
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa