PDB entry 5cfd

View 5cfd on RCSB PDB site
Description: Crystal Structure of DTT treated Human Cardiovirus SAFV-3
Class: virus
Keywords: Virion, capsid, DTT, saffold virus, pathogen, virus
Deposited on 2015-07-08, released 2016-06-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-08-24, with a file datestamp of 2016-08-18.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: vp1
    Species: SAFFOLD VIRUS [TaxId:434309]
    Database cross-references and differences (RAF-indexed):
    • Uniprot C0MHL9 (0-251)
      • conflict (35)
    Domains in SCOPe 2.07: d5cfda_
  • Chain 'B':
    Compound: vp3
    Species: SAFFOLD VIRUS [TaxId:434309]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cfdb_
  • Chain 'C':
    Compound: vp2
    Species: SAFFOLD VIRUS [TaxId:434309]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: vp4
    Species: SAFFOLD VIRUS [TaxId:434309]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cfdA (A:)
    gvdnaekgkvsddnastdfvaepvklpenqtrvsffydrstlssvlqstsdvsskftpst
    aknlqnsilltplpsdivnnsvlpeqerwisfaspttqkppyktkqdwnfimfspftyyk
    cdlevtlskndretissvvryvpcgapsdlsdqtmpqtpsladtrdphmwvvgqgttnqi
    sfvipytsplsvlpsvwfngfsnfdnssrfgvapnadfgrlllqgqgtfsvhyrykkmrv
    fcprptvfipwp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cfdB (B:)
    spfpvtvrehagtffsttpdttvpvygntistpfdymcgeftdllslckiptflgnldsn
    kkripyfsatnstpatplvtyqvtlscscmansmlaavarnfnqyrgslnylfvftgsam
    tkgkflisytppgagepktldqamqatyaiwdlglnssynftvpfispthyrqtsyntpt
    itsvdgwltvwqltpltyplgvpndshiltlvsggddftlrmpvtftkyvpq
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.