PDB entry 5cf9

View 5cf9 on RCSB PDB site
Description: Cleavage of nicotinamide adenine dinucleotide by the ribosome inactivating protein of Momordica charantia - enzyme-NADP+ co-crystallisation.
Class: hydrolase
Keywords: Product, complex, glycosidase, NADP, hydrolase
Deposited on 2015-07-08, released 2015-07-22
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-06-29.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'B':
  Compound: Ribosome-inactivating protein momordin I
  Species: Momordica charantia [TaxId:3673]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16094 (0-245)
  Domains in SCOPe 2.08: d5cf9b_
• Heterogens: NAG, NCA, HOH

PDB Chain Sequences:

• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5cf9B (B:)
  dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
  tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
  prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
  pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
  lntrni