PDB entry 5cee

View 5cee on RCSB PDB site
Description: Malic enzyme from Candidatus Phytoplasma AYWB in complex with NAD and Mg2+
Class: oxidoreductase
Keywords: phytoplasm malic enzyme, malate metabolism, plant pathogen, OXIDOREDUCTASE
Deposited on 2015-07-06, released 2016-10-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-10-05, with a file datestamp of 2016-09-30.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent malic enzyme
    Species: Aster yellows witches'-broom phytoplasma (strain AYWB) [TaxId:322098]
    Gene: sfcA, AYWB_051
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5ceea1, d5ceea2
  • Heterogens: NAD, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5ceeA (A:)
    mgsshhhhhhssglvprgshmasmnikekalemheknkgkvgvvskvkvqnlddlslvyt
    pgvaepclkikenpsdvyrytmkgnmvgvitngtavlglgnigpkaslpvmegkailfke
    lagidsfpicidstdsqeivnivskistvfgainledikspqcieiedalkakldipvfh
    ddqhgtaivvaagilnalkvvkksiedvqvvingagsagmaiakmllllkvnnvvlvdkt
    gtlykgvanlnepqkklvevtnkyqekgtlkevlkgkdifigvsapgivtaemvatmakd
    aivfalanpvpeimpdeakkggarivatgrsdfpnqvnnclafpgvfrgtldakatqite
    emkkaatyalkniikeqdlnennilptsfnkevvkqialavckvaketgvvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5ceeA (A:)
    ikekalemheknkgkvgvvskvkvqnlddlslvytpgvaepclkikenpsdvyrytmkgn
    mvgvitngtavlglgnigpkaslpvmegkailfkelagidsfpicidstdsqeivnivsk
    istvfgainledikspqcieiedalkakldipvfhddqhgtaivvaagilnalkvvkksi
    edvqvvingagsagmaiakmllllkvnnvvlvdktgtlykgvanlnepqkklvevtnkyq
    ekgtlkevlkgkdifigvsapgivtaemvatmakdaivfalanpvpeimpdeakkggari
    vatgrsdfpnqvnnclafpgvfrgtldakatqiteemkkaatyalkniikeqdlnennil
    ptsfnkevvkqialavckvaketgvvr