PDB entry 5cdy

View 5cdy on RCSB PDB site
Description: The crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (FabG) from Yersinia pestis at 2.85A resolution
Class: oxidoreductase
Keywords: FabG, reductase, FASII, Rossmann, OXIDOREDUCTASE
Deposited on 2015-07-06, released 2015-11-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-11-18, with a file datestamp of 2015-11-13.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Yersinia pestis [TaxId:632]
    Gene: fabG, y1758, YPO1599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cdya_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Yersinia pestis [TaxId:632]
    Gene: fabG, y1758, YPO1599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cdyb_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Yersinia pestis [TaxId:632]
    Gene: fabG, y1758, YPO1599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cdyc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Yersinia pestis [TaxId:632]
    Gene: fabG, y1758, YPO1599
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5cdyd_
  • Heterogens: PO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cdyA (A:)
    msfegkialvtgasrgigraiaellvergacvigtatsekgaeaisaylgengkglmlnv
    vdptsidtvlatiraefgevdilvnnagitrdnllmrmkddewqdiidtnltsvfrlska
    vmrammkkrfgriitigsvvgtmgnagqvnyaaakagvigfskslarevasrgitvnvva
    pgfietdmtrtltddqragilaqvpanrlgdakeiasavaflasdeasyisgetlhvngg
    mymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cdyA (A:)
    msfegkialvtgasrgigraiaellvergacvigtatsekgaeaisaylgengkglmlnv
    vdptsidtvlatiraefgevdilvnnagitrdnllmrmkddewqdiidtnltsvfrlska
    vmrammkkrfgriitigsgqvnyaaakagvigfskslarevasrgitvnvvapgfietnr
    lgdakeiasavaflasdeasyisgetlhvnggm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cdyB (B:)
    msfegkialvtgasrgigraiaellvergacvigtatsekgaeaisaylgengkglmlnv
    vdptsidtvlatiraefgevdilvnnagitrdnllmrmkddewqdiidtnltsvfrlska
    vmrammkkrfgriitigsvvgtmgnagqvnyaaakagvigfskslarevasrgitvnvva
    pgfietdmtrtltddqragilaqvpanrlgdakeiasavaflasdeasyisgetlhvngg
    mymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cdyB (B:)
    msfegkialvtgasrgigraiaellvergacvigtatsekgaeaisaylgengkglmlnv
    vdptsidtvlatiraefgevdilvnnagitrdnllmrmkddewqdiidtnltsvfrlska
    vmrammkkrfgriitigsgqvnyaaakagvigfskslarevasrgitvnvvapgdakeia
    savaflasdeasyisgetlhvnggm
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cdyC (C:)
    msfegkialvtgasrgigraiaellvergacvigtatsekgaeaisaylgengkglmlnv
    vdptsidtvlatiraefgevdilvnnagitrdnllmrmkddewqdiidtnltsvfrlska
    vmrammkkrfgriitigsvvgtmgnagqvnyaaakagvigfskslarevasrgitvnvva
    pgfietdmtrtltddqragilaqvpanrlgdakeiasavaflasdeasyisgetlhvngg
    mymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cdyC (C:)
    msfegkialvtgasrgigraiaellvergacvigtatsekgaeaisaylgengkglmlnv
    vdptsidtvlatiraefgevdilvnnagitrdnllmrmkddewqdiidtnltsvfrlska
    vmrammkkrfgriitigsgqvnyaaakagvigfskslarevasrgitvnvvapgfrlgda
    keiasavaflasdeasyisgetlhvnggm
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cdyD (D:)
    msfegkialvtgasrgigraiaellvergacvigtatsekgaeaisaylgengkglmlnv
    vdptsidtvlatiraefgevdilvnnagitrdnllmrmkddewqdiidtnltsvfrlska
    vmrammkkrfgriitigsvvgtmgnagqvnyaaakagvigfskslarevasrgitvnvva
    pgfietdmtrtltddqragilaqvpanrlgdakeiasavaflasdeasyisgetlhvngg
    mymi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cdyD (D:)
    msfegkialvtgasrgigraiaellvergacvigtatsekgaeaisaylgengkglmlnv
    vdptsidtvlatiraefgevdilvnnagitrdnllmrmkddewqdiidtnltsvfrlska
    vmrammkkrfgriitigsgqvnyaaakagvigfskslarevasrgitvnvvapgfdakei
    asavaflasdeasyisgetlhvngg