PDB entry 5cdk

View 5cdk on RCSB PDB site
Description: Apical domain of chloroplast chaperonin 60b1
Class: chaperone
Keywords: apical domain CPN60b1, CHAPERONE
Deposited on 2015-07-04, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Chaperonin 60B1
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Gene: CPN60B1, CHLREDRAFT_132530
    Database cross-references and differences (RAF-indexed):
    • Uniprot A8JE91 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.07: d5cdka1, d5cdka2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cdkA (A:)
    sqfergytspyfvtdpermiceyenckillvdkkistardiitilesairgnypllimae
    eveqealatlvvnklrgtlkvvaikapgfgerrssylediailtggtvvrdemgvsleqa
    tdavlgtaakititkerttvvgdgstaadvaarvkqirnlqmqtdqdyereklqeriarl
    sgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cdkA (A:)
    sqfergytspyfvtdpermiceyenckillvdkkistardiitilesairgnypllimae
    eveqealatlvvnklrgtlkvvaikapgfgerrssylediailtggtvvrdemgvsleqa
    tdavlgtaakititkerttvvgdgstaadvaarvkqirnlqmqtdqdyereklqeriarl
    s