PDB entry 5cdj

View 5cdj on RCSB PDB site
Description: apical domain of chloroplast chaperonin 60a
Class: chaperone
Keywords: chaperone
Deposited on 2015-07-04, released 2016-07-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-05-17, with a file datestamp of 2017-05-12.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RuBisCO large subunit-binding protein subunit alpha, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cdja_
  • Chain 'B':
    Compound: RuBisCO large subunit-binding protein subunit alpha, chloroplastic
    Species: Chlamydomonas reinhardtii [TaxId:3055]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5cdjb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cdjA (A:)
    segmeidrgyispqfvtnqerllveydncrvlvtdqkidairdiipileqvtrlnaplli
    iaedvsgealatlvvnklrgvlnvcaikapgfgerrksllqdiaivtgaefiakdlgmkv
    eqavveqlgvarkvtvanntttliadaaskdeiemriaqlkkelaetdsvydteklseri
    aklsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cdjA (A:)
    gmeidrgyispqfvtnqerllveydncrvlvtdqkidairdiipileqvtrlnaplliia
    edvsgealatlvvnklrgvlnvcaikapgfgerrksllqdiaivtgaefiakdlgmkveq
    avveqlgvarkvtvanntttliadaaskdeiemriaqlkkelaetdsvydteklseriak
    ls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cdjB (B:)
    segmeidrgyispqfvtnqerllveydncrvlvtdqkidairdiipileqvtrlnaplli
    iaedvsgealatlvvnklrgvlnvcaikapgfgerrksllqdiaivtgaefiakdlgmkv
    eqavveqlgvarkvtvanntttliadaaskdeiemriaqlkkelaetdsvydteklseri
    aklsgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cdjB (B:)
    gmeidrgyispqfvtnqerllveydncrvlvtdqkidairdiipileqvtrlnaplliia
    edvsgealatlvvnklrgvlnvcaikapgfgerrksllqdiaivtgaefiakdlgmkveq
    avveqlgvarkvtvanntttliadaaskdeiemriaqlkkelaetdsvydteklseriak
    lsg