PDB entry 5cct

View 5cct on RCSB PDB site
Description: Staphylococcus bacteriophage 80alpha dUTPase G164S mutant with dUpNHpp.
Class: hydrolase
Keywords: phage, pathogenicity island, SaPI induction, gene transfer, moonlighting proteins, Dut, dUTP, G protein, P-loop, hydrolase
Deposited on 2015-07-02, released 2016-05-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-13, with a file datestamp of 2017-09-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dutpase
    Species: STAPHYLOCOCCUS PHAGE 80ALPHA [TaxId:53369]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A4ZF98 (Start-169)
      • engineered mutation (163)
    Domains in SCOPe 2.07: d5ccta_
  • Heterogens: DUP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cctA (A:)
    mtntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgl
    ltsrsgvsskthlvietgkidagyhgnlginikndheddkmqtiflrnidnekifekerh
    lyklgsyriekgeriaqlvivpiwtpelkqveefesvsergeksfgssgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cctA (A:)
    tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
    tsrsgvsskthlvietgkidagyhgnlginikndheddkmqtiflrnidnekifekerhl
    yklgsyriekgeriaqlvivpiwtpelkqveefesvsergeksfgssgv