PDB entry 5cc3

View 5cc3 on RCSB PDB site
Description: Crystal structure of Mycobacterium tuberculosis malate synthase in complex with 6-bromo-1H-indole-2-carboxylic acid
Class: transferase
Keywords: Complex, Fragment, TRANSFERASE
Deposited on 2015-07-01, released 2016-08-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-09-27, with a file datestamp of 2017-09-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate synthase g
    Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) [TaxId:83332]
    Gene: glcB, Rv1837c, MTCY1A11.06
    Database cross-references and differences (RAF-indexed):
    • Uniprot P9WK17
      • conflict (618)
    Domains in SCOPe 2.07: d5cc3a_
  • Heterogens: MG, 4ZU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cc3A (A:)
    mtdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardel
    qaqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvp
    vlnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsv
    plssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhie
    ilidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdla
    aavdkdgtaflrvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfe
    gimdalftgliaihglkasdvngplinsrtgsiyivkpkmhgpaevaftcelfsrvedvl
    glpqntmkigimdeerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrk
    gtmksqpwilayedhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragasta
    wvpsptaatlhalhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdn
    ncqsilgyvvrwvdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvra
    slermaplvdrqnagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrre
    fkaraaekpapsdragddaar
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cc3A (A:)
    tdrvsvgnlriarvlydfvnnealpgtdidpdsfwagvdkvvadltpqnqallnardelq
    aqidkwhrrrviepidmdayrqflteigyllpepddftittsgvdaeitttagpqlvvpv
    lnarfalnaanarwgslydalygtdvipetdgaekgptynkvrgdkviayarkflddsvp
    lssgsfgdatgftvqdgqlvvalpdkstglanpgqfagytgaaesptsvllinhglhiei
    lidpesqvgttdragvkdvilesaittimdfedsvaavdaadkvlgyrnwlglnkgdlaa
    rvlnrdrnytapgggqftlpgrslmfvrnvghlmtndaivdtdgsevfegimdalftgli
    aihglkasdvgplinsrtgsiyivkpkmhgpaevaftcelfsrvedvlglpqntmkigim
    deerrttvnlkacikaaadrvvfintgfldrtgdeihtsmeagpmvrkgtmksqpwilay
    edhnvdaglaagfsgraqvgkgmwtmtelmadmvetkiaqpragastawvpsptaatlha
    lhyhqvdvaavqqglagkrratieqlltiplakelawapdeireevdnncqsilgyvvrw
    vdqgvgaskvpdihdvalmedratlrissqllanwlrhgvitsadvraslermaplvdrq
    nagdvayrpmapnfddsiaflaaqelilsgaqqpngytepilhrrrrefkaraae