PDB entry 5cbl

View 5cbl on RCSB PDB site
Description: Crystal structure of the C-terminal domain of human galectin-4 with lactose
Class: sugar binding protein
Keywords: galectins, beta-galactosides binding, SUGAR BINDING PROTEIN
Deposited on 2015-07-01, released 2015-11-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-11-04, with a file datestamp of 2015-10-30.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cbla_
  • Chain 'B':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cblb_
  • Chain 'C':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cblc_
  • Chain 'D':
    Compound: Galectin-4
    Species: Homo sapiens [TaxId:9606]
    Gene: LGALS4
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d5cbld_
  • Heterogens: LAT, BME, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cblA (A:)
    seflptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdial
    hinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlf
    dfahrlsafqrvdtleiqgdvtlsyvqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cblA (A:)
    gpptfnppvpyfgrltarrtiiikgyvpptgksfainfkvsgdialhinprmgngtvvrn
    sllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsvdtleiq
    gdvtlsyvqi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cblB (B:)
    seflptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdial
    hinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlf
    dfahrlsafqrvdtleiqgdvtlsyvqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cblB (B:)
    gpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgsgdialhinprmgng
    tvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsaf
    qrvdtleiqgdvtlsyvqi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5cblC (C:)
    seflptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdial
    hinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlf
    dfahrlsafqrvdtleiqgdvtlsyvqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cblC (C:)
    pptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvsgdialhinprmgngtv
    vrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsaqrv
    dtleiqgdvtlsyvqi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5cblD (D:)
    seflptmegpptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgssgdial
    hinprmgngtvvrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlf
    dfahrlsafqrvdtleiqgdvtlsyvqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cblD (D:)
    ptfnppvpyfgrlqggltarrtiiikgyvpptgksfainfkvgsgdialhinprmgngtv
    vrnsllngswgseekkithnpfgpgqffdlsircgldrfkvyangqhlfdfahrlsafqr
    vdtleiqgdvtlsyvqi