PDB entry 5cb7

View 5cb7 on RCSB PDB site
Description: Crystallographic structure of human rotavirus K8 VP8* in complex with A-type HBGA
Class: viral protein, sugar binding protein
Keywords: carbohydrate-recognizing protein, lectin, rotavirus, VP8*, viral protein, sugar binding protein
Deposited on 2015-06-30, released 2016-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A (strain Human/Japan/K8/1977 G1-P3A[9]-Ix-Rx-Cx-Mx-A1-Nx-Tx-Ex-H3) [TaxId:39012]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01641 (Start-160)
      • engineered mutation (85)
    Domains in SCOPe 2.06: d5cb7a_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A (strain Human/Japan/K8/1977 G1-P3A[9]-Ix-Rx-Cx-Mx-A1-Nx-Tx-Ex-H3) [TaxId:39012]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01641 (Start-160)
      • engineered mutation (85)
    Domains in SCOPe 2.06: d5cb7b_
  • Heterogens: A2G, GLA, FUC, GAL, GOL, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5cb7A (A:)
    tldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldg
    qnvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpn
    asesyyltinndnsnvssdaefylipqsqtamctqyinngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cb7A (A:)
    ldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldgq
    nvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpna
    sesyyltinndnsnvssdaefylipqsqtamctqyinngl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5cb7B (B:)
    tldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldg
    qnvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpn
    asesyyltinndnsnvssdaefylipqsqtamctqyinngl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5cb7B (B:)
    ldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldgq
    nvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpna
    sesyyltinndnsnvssdaefylipqsqtamctqyinngl