PDB entry 5caz

View 5caz on RCSB PDB site
Description: Crystallographic structure of apo human rotavirus K8 VP8*
Class: viral protein, sugard binding protein
Keywords: carbohydrate-recognizing protein, lectin, rotavirus, VP8*, viral protein, sugard binding protein
Deposited on 2015-06-30, released 2016-06-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2016-06-08, with a file datestamp of 2016-06-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A (strain Human/Japan/K8/1977 G1-P3A[9]-Ix-Rx-Cx-Mx-A1-Nx-Tx-Ex-H3) [TaxId:39012]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q01641 (0-160)
      • engineered mutation (85)
    Domains in SCOPe 2.06: d5caza_
  • Heterogens: IPA, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5cazA (A:)
    tldgpyqptslnlpvdywmliaptregkvaegtnttdrwfacvlvepnvqntqrqyvldg
    qnvqlhvsndsstswkfilfikltpdgtytqystlstphklcawmkrdnrvywyqgatpn
    asesyyltinndnsnvssdaefylipqsqtamctqyinngl