PDB entry 5cap

View 5cap on RCSB PDB site
Description: EGFR kinase domain mutant "TMLR" with compound 30
Class: Transferase/transferase inhibitor
Keywords: protein kinase inhibitor, Transferase-transferase inhibitor complex
Deposited on 2015-06-29, released 2015-10-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-12-02, with a file datestamp of 2015-11-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533
      • engineered mutation (96)
      • engineered mutation (164)
    Domains in SCOPe 2.07: d5capa_
  • Heterogens: SO4, 4ZH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5capA (A:)
    gsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatsp
    kankeildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqy
    llnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakllgaaaaeyhaeg
    gkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekgerl
    pqppictidvymimvkcwmidadsrpkfreliiefskmardpqrylviqgdermhlpspt
    dsnfyralmdeedmddvvdadeylipqqgns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5capA (A:)
    eapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikelreatspkan
    keildeayvmasvdnphvcrllgicltstvqlimqlmpfgclldyvrehkdnigsqylln
    wcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfgrakvpikwmalesilhriy
    thqsdvwsygvtvwelmtfgskpydgipaseissilekgerlpqppictidvymimvkcw
    midadsrpkfreliiefskmardpqrylviqgdermhlpsptdsnfyradmddvvdadey
    lip