PDB entry 5cae

View 5cae on RCSB PDB site
Description: Succinate bound to pig GTP-specific succinyl-CoA synthetase
Class: ligase
Keywords: ligase
Deposited on 2015-06-29, released 2016-06-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5caea1, d5caea2
  • Chain 'B':
    Compound: Succinyl-CoA ligase [GDP-forming] subunit beta, mitochondrial
    Species: Sus scrofa [TaxId:9823]
    Gene: SUCLG2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53590 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d5caeb1, d5caeb2
  • Heterogens: COA, CL, GOL, PO4, MG, SIN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5caeA (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krkmllvhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5caeA (A:)
    sytasrkhlyvdkntkvicqgftgkqgtfhsqqaleygtnlvggttpgkggkthlglpvf
    ntvkeakeqtgatasviyvpppfaaaaineaidaevplvvcitegipqqdmvrvkhrllr
    qgktrligpncpgvinpgeckigimpghihkkgrigivsrsgtltyeavhqttqvglgqs
    lcvgiggdpfngtdftdcleiflndpategiiligeiggnaeenaaeflkqhnsgpkskp
    vvsfiagltappgrrmghagaiiaggkggakekitalqsagvvvsmspaqlgttiykefe
    krk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5caeB (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvtkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5caeB (B:)
    mnlqeyqskklmsdngvkvqrffvadtanealeaakrlnakeivlkaqilaggrgkgvfs
    sglkggvhltkdpevvgqlakqmigynlatkqtpkegvkvnkvmvaealdisretylail
    mdrscngpvlvgspqggvdieevaasnpelifkeqidiiegikdsqaqrmaenlgflgpl
    qnqaadqikklynlflkidatqvevnpfgetpegqvvcfdakinfddnaefrqkdifamd
    dksenepieneaakydlkyigldgniacfvngaglamatcdiiflnggkpanfldlgggv
    kesqvyqafklltadpkveailvnifggivncaiiangitkacrelelkvplvvrlegtn
    vheaqniltnsglpitsavdledaakkavasvt