PDB entry 5c9y

View 5c9y on RCSB PDB site
Description: Crystal structure of yellow lupine LlPR-10.1A protein partially saturated with trans-zeatin
Class: plant protein
Keywords: pr-10 fold, ligand binding, phytohormone binding protein, trans-zeatin, cytokinin, plant protein
Deposited on 2015-06-29, released 2015-12-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-01-13, with a file datestamp of 2016-01-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein llr18a
    Species: Lupinus luteus [TaxId:3873]
    Gene: LLR18A
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5c9ya_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9yA (A:)
    gifafeneqsstvapaklykaltkdsdeivpkviepiqsveivegnggpgtikkiiaihd
    ghtsfvlhkldaideanltynysiiggegldeslekisyeskilpgpdggsigkinvkfh
    tkgdvlsetvrdqakfkglglfkaiegyvlahpdy