PDB entry 5c9k
View 5c9k on RCSB PDB site
Description: Crystal structure of a highly fibrillogenic Arg24Gly mutant of the Recombinant variable domain 6AJL2
Class: immune system
Keywords: lambda vi subgroup, beta-sandwich, immunoglobulin, al amyloidosis, immune system
Deposited on
2015-06-27, released
2015-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated
2015-08-05, with a file datestamp of
2015-07-31.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c9ka1, d5c9ka2 - Chain 'B':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c9kb1, d5c9kb2 - Chain 'C':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c9kc1, d5c9kc2 - Chain 'D':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c9kd1, d5c9kd2 - Chain 'E':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c9ke1, d5c9ke2 - Chain 'F':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c9kf1, d5c9kf2 - Chain 'G':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c9kg1, d5c9kg2 - Chain 'H':
Compound: amyloid lambda 6 light chain variable region pip
Species: Homo sapiens [TaxId:9606]
Gene: VL gene segment 6a and JL2/3 gene segment
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.06: d5c9kh1, d5c9kh2 - Heterogens: ACT, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>5c9kA (A:)
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>5c9kB (B:)
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>5c9kC (C:)
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>5c9kD (D:)
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'E':
Sequence; same for both SEQRES and ATOM records: (download)
>5c9kE (E:)
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'F':
Sequence, based on SEQRES records: (download)
>5c9kF (F:)
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
Sequence, based on observed residues (ATOM records): (download)
>5c9kF (F:)
fmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvpd
rfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'G':
Sequence; same for both SEQRES and ATOM records: (download)
>5c9kG (G:)
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
- Chain 'H':
Sequence; same for both SEQRES and ATOM records: (download)
>5c9kH (H:)
nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl