PDB entry 5c9k

View 5c9k on RCSB PDB site
Description: Crystal structure of a highly fibrillogenic Arg24Gly mutant of the Recombinant variable domain 6AJL2
Class: immune system
Keywords: lambda vi subgroup, beta-sandwich, immunoglobulin, al amyloidosis, immune system
Deposited on 2015-06-27, released 2015-08-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-08-05, with a file datestamp of 2015-07-31.
Experiment type: XRAY
Resolution: 1.92 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 5C9K (0-110)
    Domains in SCOPe 2.06: d5c9ka1, d5c9ka2
  • Chain 'B':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 5C9K (0-110)
    Domains in SCOPe 2.06: d5c9kb1, d5c9kb2
  • Chain 'C':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 5C9K (0-110)
    Domains in SCOPe 2.06: d5c9kc1, d5c9kc2
  • Chain 'D':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 5C9K (0-110)
    Domains in SCOPe 2.06: d5c9kd1, d5c9kd2
  • Chain 'E':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 5C9K (0-110)
    Domains in SCOPe 2.06: d5c9ke1, d5c9ke2
  • Chain 'F':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 5C9K (Start-110)
    Domains in SCOPe 2.06: d5c9kf1, d5c9kf2
  • Chain 'G':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 5C9K (0-110)
    Domains in SCOPe 2.06: d5c9kg1, d5c9kg2
  • Chain 'H':
    Compound: amyloid lambda 6 light chain variable region pip
    Species: Homo sapiens [TaxId:9606]
    Gene: VL gene segment 6a and JL2/3 gene segment
    Database cross-references and differences (RAF-indexed):
    • PDB 5C9K (0-110)
    Domains in SCOPe 2.06: d5c9kh1, d5c9kh2
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9kA (A:)
    nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9kB (B:)
    nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9kC (C:)
    nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9kD (D:)
    nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9kE (E:)
    nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5c9kF (F:)
    nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c9kF (F:)
    fmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvpd
    rfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9kG (G:)
    nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5c9kH (H:)
    nfmltqphsvsespgktvtisctgssgsiasnyvqwyqqrpgsspttviyednqrpsgvp
    drfsgsidsssnsasltisglktedeadyycqsydssnhvvfgggtkltvl