PDB entry 5c90

View 5c90 on RCSB PDB site
Description: Staphylococcus aureus ClpP mutant - Y63A
Class: hydrolase
Keywords: Clp protease, proteolysis, HYDROLASE
Deposited on 2015-06-26, released 2016-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-07-27, with a file datestamp of 2016-07-22.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90a_
  • Chain 'B':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90b_
  • Chain 'C':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90c_
  • Chain 'D':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90d_
  • Chain 'E':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90e_
  • Chain 'F':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90f_
  • Chain 'G':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90g_
  • Chain 'H':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90h_
  • Chain 'I':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90i_
  • Chain 'J':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90j_
  • Chain 'K':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90k_
  • Chain 'L':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90l_
  • Chain 'M':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90m_
  • Chain 'N':
    Compound: ATP-dependent Clp protease proteolytic subunit
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: clpP, SAOUHSC_00790
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2G036
      • engineered mutation (62)
    Domains in SCOPe 2.07: d5c90n_
  • Heterogens: MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5c90A (A:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90A (A:)
    ptviydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsvta
    gfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqa
    teieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5c90B (B:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90B (B:)
    liptvieteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylains
    pggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqpl
    ggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygli
    devmvpe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5c90C (C:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90C (C:)
    liptvraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggs
    vtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaq
    gqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevm
    vp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5c90D (D:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90D (D:)
    liptaydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsvt
    agfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgq
    ateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5c90E (E:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90E (E:)
    liptvieraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspg
    gsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplgg
    aqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglide
    vmvpet
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5c90F (F:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90F (F:)
    liptvieeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainsp
    ggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplg
    gaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglid
    evmvpe
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5c90G (G:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90G (G:)
    iptvietteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylains
    pggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqpl
    ggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeygli
    devmvp
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5c90H (H:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90H (H:)
    iptvydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsvta
    gfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqa
    teieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >5c90I (I:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90I (I:)
    iptvydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsvta
    gfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqa
    teieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >5c90J (J:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90J (J:)
    iptvieteraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainsp
    ggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplg
    gaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglid
    evmvp
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >5c90K (K:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90K (K:)
    liptvieeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainsp
    ggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplg
    gaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglid
    evmvpe
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5c90L (L:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90L (L:)
    liptvaydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsv
    tagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqg
    qateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmv
    pe
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >5c90M (M:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90M (M:)
    iptvydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsvta
    gfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqa
    teieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvpe
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >5c90N (N:)
    mnliptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdi
    ylainspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaev
    mihqplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeea
    keyglidevmvpetk
    

    Sequence, based on observed residues (ATOM records): (download)
    >5c90N (N:)
    iptviydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsvt
    agfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgq
    ateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp
    e